PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01534.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 345aa    MW: 38764.4 Da    PI: 8.3911
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01534.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.4e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Rsa1.0_01534.1_g00009.1 14 KGLWSPEEDEKLLNYIARHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                             678*******************************************97 PP

2Myb_DNA-binding47.83.4e-1567110146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+++++E+ l++++++ lG++ W+ Ia +++ gRt++++k++w++
  Rsa1.0_01534.1_g00009.1  67 RGAFSQDEEGLIIELHAALGNR-WSQIATRLP-GRTDNEIKNFWNS 110
                              89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.886965IPR017930Myb domain
SuperFamilySSF466893.44E-2911108IPR009057Homeodomain-like
SMARTSM007171.6E-131363IPR001005SANT/Myb domain
PfamPF002499.7E-171461IPR001005SANT/Myb domain
CDDcd001678.60E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129420.5766116IPR017930Myb domain
SMARTSM007177.4E-1466114IPR001005SANT/Myb domain
PfamPF002496.1E-1467111IPR001005SANT/Myb domain
CDDcd001673.39E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRHSCCYKP KLRKGLWSPE EDEKLLNYIA RHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEEGLIIE LHAALGNRWS QIATRLPGRT DNEIKNFWNS CLKKKLRRKG  120
IDPTTHKPLI SDLQTLNVIN QKLTSSQVVK STGLINNPHE PSMVVSSQPG PWWFPSMANQ  180
NAAFCFSSST TPSVSDHIVS LISSMSTSSS TTSMTSNFNP FPELYYCNNT VPSQTNSIYS  240
AFFGNSFTEA SQINNNNNPV VDDHPHGQDM KSWASEILHY TEHNQSSETG LEAEVKPDIG  300
KYYWRSTSSS SSPNENAATL LHDADVQWYG KNLQKLNNMA FDQSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281011623128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0997770.0AY099777.1 Arabidopsis thaliana transcription factor ATMYB4 (At5g26655) mRNA, complete cds.
GenBankAY5196290.0AY519629.1 Arabidopsis thaliana MYB transcription factor (At5g26660) mRNA, complete cds.
GenBankBT0087400.0BT008740.1 Arabidopsis thaliana At5g26655 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013609802.10.0PREDICTED: transcription factor MYB86-like
SwissprotQ8LPH60.0MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A078CTV00.0A0A078CTV0_BRANA; BnaC07g28680D protein
TrEMBLA0A0D3E1810.0A0A0D3E181_BRAOL; Uncharacterized protein
STRINGAT5G26660.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.10.0myb domain protein 86